PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT09005
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 80aa    MW: 9255.58 Da    PI: 9.46
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT09005genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY77.51.6e-243875239
              --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEE CS
      WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkve 39
              dDgy+WrKYGqK +k+s++prsYYrCt ++C++kk+v+
  EMT09005 38 DDGYKWRKYGQKAIKNSPNPRSYYRCTNPRCNAKKQVD 75
              8************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.6E-223275IPR003657WRKY domain
PROSITE profilePS5081121.1723280IPR003657WRKY domain
SuperFamilySSF1182901.44E-203577IPR003657WRKY domain
SMARTSM007742.1E-173780IPR003657WRKY domain
PfamPF031063.6E-193875IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MEEMGEESSR VFSPEKVLGK MENKYTMKIK SCGNGLADDG YKWRKYGQKA IKNSPNPRSY  60
YRCTNPRCNA KKQVDIIELD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-1536801660Probable WRKY transcription factor 4
2lex_A6e-1536801660Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-76HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002459179.15e-39hypothetical protein SORBIDRAFT_03g047350
SwissprotQ9FHR71e-25WRK49_ARATH; Probable WRKY transcription factor 49
TrEMBLM8B5W53e-54M8B5W5_AEGTA; Putative WRKY transcription factor 49
STRINGMLOC_7470.12e-41(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75253551
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.16e-27WRKY DNA-binding protein 49